PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G054800.1.p
Common NameGLYMA_04G054800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 392aa    MW: 44611 Da    PI: 5.4633
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G054800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK42.51.3e-13289336350
               RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50 
                          ++++l+dls  F+ ++k+A + L++++T++K iCR+  +  WPhR+++
  Glyma.04G054800.1.p 289 NSMTLDDLSGVFHITMKAAKNVLDMSVTAIKSICRKCRLYKWPHRQLQ 336
                          689*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.424270358IPR003035RWP-RK domain
PfamPF020422.1E-13290336IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MDNNNNNNIN SSVFVSYACR DPFVSPLLDN FNEPDPALVY LLPEPNLRND EQQPLQGHVS  60
STDSTIHDQS HHYCNDNFTI GGGVFPNYEF VEGSSKNKRK YPFTDTDIED QSFMHDFEAG  120
PSNLNQPASG NMGPRNWPPM PRPFFCTCCQ VLRQTIHTNG TDFERLEIHG RIGLISHIII  180
QNQSITPGGR SCDNYQMIDF TNGSPAEVKG FLEDYIARKD KLGYIIAEES FSEFYEAVCT  240
KLDWVGKRTN NEDDDLTPQN VEEEPEPEPE PPKERRRKRS RKDQSDRINS MTLDDLSGVF  300
HITMKAAKNV LDMSVTAIKS ICRKCRLYKW PHRQLQPLAR RLKVLKRALE SSQDPVVIQT  360
TSMEVRRIKQ HMTQLCGGVT PTGIEIPEVE E*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1275282RRKRSRKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014630526.11e-147PREDICTED: uncharacterized protein LOC102665948
TrEMBLK7KI920.0K7KI92_SOYBN; Uncharacterized protein
STRINGGLYMA04G05755.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74782846
Representative plantOGRP1033348